DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and cpz-2

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_506318.1 Gene:cpz-2 / 179818 WormBaseID:WBGene00000789 Length:467 Species:Caenorhabditis elegans


Alignment Length:345 Identity:90/345 - (26%)
Similarity:140/345 - (40%) Gaps:92/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FEENFKV---------IEEHNQNYKE-------------------GQTSFRLKPNIFA------- 89
            ||.|.||         |.::||..:|                   .:....|.|.|.|       
 Worm    98 FELNKKVNKPVVRYPNIAKNNQKIREEIVYPADFDEHVVEILDSRKERKIDLSPMIKAKLEKGYY 162

  Fly    90 --------DMSTDG------------YLK-GFLRLLKS-NIEDSADNMAEIVGSPLMAN-VPESL 131
                    |||::.            ||| |.|:  || .:.:|.....|...|...:| :|...
 Worm   163 EPNDEALVDMSSESEESSEEWEEARPYLKCGCLK--KSGKVFESKTAPREWESSSFKSNDLPTGW 225

  Fly   132 DWRS---KGFITPPYNQ---LSCGSCYAFSIAESIMGQV-FKRTGK--ILSLSKQQIVDCSVSHG 187
            |||:   ..:.:|..||   :.||||:.|....::..:. ..|.|:  :..||.|:|:||   :|
 Worm   226 DWRNVSGVNYCSPTRNQHIPVYCGSCWVFGTTGALNDRFNVARKGRWPMTQLSPQEIIDC---NG 287

  Fly   188 NQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKC-------QFVPD--LSVVNVTSWAIL-- 241
            ...|.||.:.|.|.:.: ..|::.:....|.|..|:|       ...|:  .|:.|.|.:.:.  
 Worm   288 KGNCQGGEIGNVLEHAK-IQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSLTNYTRYYVKDY 351

  Fly   242 -PVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGFGKD----- 300
             .|:....|.:.:...||:|.:|.|:.|....|..|:|.:.  |....||.:.:.|:|.|     
 Worm   352 GQVQGRDKIMSEIKKGGPIACAIGATKKFEYEYVKGVYSEK--SDLESNHIISLTGWGVDENGVE 414

  Fly   301 YWILKNWWGQNWGENGYIRI 320
            |||.:|.||:.|||.|:.|:
 Worm   415 YWIARNSWGEAWGELGWFRV 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 16/90 (18%)
Peptidase_C1A 128..336 CDD:239068 63/219 (29%)
cpz-2NP_506318.1 Peptidase_C1A_CathepsinX 221..461 CDD:239149 63/220 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.