DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and F32H5.1

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_506310.1 Gene:F32H5.1 / 179815 WormBaseID:WBGene00009347 Length:356 Species:Caenorhabditis elegans


Alignment Length:304 Identity:77/304 - (25%)
Similarity:117/304 - (38%) Gaps:91/304 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LRLLKSNIEDSADNMAEIVGSP-LMANVPESLD----WRSKGFITPPYNQLSCGSCYAFSIAESI 160
            ::.:|||     |.::|..|:. ::.::|.|.|    |.|...|....:|..|||. |..:|..|
 Worm    70 IKFIKSN-----DEVSEKTGNDNVLVDIPSSFDSRQKWPSCSQIGAVRDQSDCGSA-AHLVAVEI 128

  Fly   161 MGQVFKRTGKILS-------LSKQQIVDC-----SVSHGNQGCVGGSLRNTLSYLQS----TGGI 209
            ...   || .|.|       ||.|..:.|     |:.....||.|...::.|.:.|:    |||.
 Worm   129 ASD---RT-CIASNGTFNWPLSAQDPLSCCVGLMSICGDGWGCDGSWPKDILKWWQTHGLCTGGN 189

  Fly   210 MRDQ-------DYPYVARKGK--------------CQFVPDLSVVNVTSWAILPVRDEQ------ 247
            ..||       .||...:...              |:   :....|:| |.|...:|:.      
 Worm   190 YNDQFGCKPYSIYPCDKKYANGTTSVPCPGYHTPTCE---EHCTSNIT-WPIAYKQDKHFGKAHY 250

  Fly   248 -------AIQAAVTHIGPVAISINASPKTFQLYSD------GIYDDPLCSSASVNHAM--VVIGF 297
                   .||..:...|||..|       |.:|.|      |||   :.::......|  .:||:
 Worm   251 NVGKKMTDIQIEIMTNGPVIAS-------FIIYDDFWDYKTGIY---VHTAGDQEGGMDTKIIGW 305

  Fly   298 GKD----YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAI 337
            |.|    ||:..:.||.::||||::|..:|||...|.:....|:
 Worm   306 GVDNGVPYWLCVHQWGTDFGENGFVRFLRGVNEVNIEHQVLAAL 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 70/273 (26%)
F32H5.1NP_506310.1 Peptidase_C1A_CathepsinB 93..348 CDD:239111 70/273 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.