DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and cpr-4

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_504682.1 Gene:cpr-4 / 179053 WormBaseID:WBGene00000784 Length:335 Species:Caenorhabditis elegans


Alignment Length:264 Identity:72/264 - (27%)
Similarity:103/264 - (39%) Gaps:67/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VPESLD----WRSKGFITPPYNQLSCGSCYAFSIAESIMGQ-VFKRTGKILS-LSKQQIVDCSVS 185
            :|.:.|    |.:...|....:|..||||:||:.||:...: .....|.:.: ||.:.::.| .|
 Worm    81 IPATFDARTQWPNCMSINNIRDQSDCGSCWAFAAAEAASDRFCIASNGAVNTLLSAEDVLSC-CS 144

  Fly   186 HGNQGCVGGSLRNTLSYLQS----TGGIMRDQDYPYVARKGKCQ---FVPDLSVVNVTSWAILP- 242
            :...||.||...|...||..    |||       .|.|:.| |:   ..|....|...:|...| 
 Worm   145 NCGYGCEGGYPINAWKYLVKSGFCTGG-------SYEAQFG-CKPYSLAPCGETVGNVTWPSCPD 201

  Fly   243 ---------------------VRDE-------------QAIQAAVTHIGPVAISINASPKTFQLY 273
                                 ..|:             ..|||.:...|||..:.......:| |
 Worm   202 DGYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVSQIQAEIIAHGPVEAAFTVYEDFYQ-Y 265

  Fly   274 SDGIYDDPLCSSASVNHAMVVIGFGKD----YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAA 334
            ..|:|......... .||:.::|:|.|    ||::.|.|..|||||||.||.:|.|.|||    .
 Worm   266 KTGVYVHTTGQELG-GHAIRILGWGTDNGTPYWLVANSWNVNWGENGYFRIIRGTNECGI----E 325

  Fly   335 YAIV 338
            :|:|
 Worm   326 HAVV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 70/259 (27%)
cpr-4NP_504682.1 Peptidase_C1A_CathepsinB 82..331 CDD:239111 72/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161071
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.