DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and CTSS

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_004070.3 Gene:CTSS / 1520 HGNCID:2545 Length:331 Species:Homo sapiens


Alignment Length:314 Identity:108/314 - (34%)
Similarity:167/314 - (53%) Gaps:33/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRL 103
            :|....::|....:|......:|:|.|.:..||..:..|..|:.|..|...||:::..:.     
Human    31 WKKTYGKQYKEKNEEAVRRLIWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMS----- 90

  Fly   104 LKSNIEDSADNMAEIVGSPLMANV----------PESLDWRSKGFITPPYNQLSCGSCYAFSIAE 158
            |.|::.         |.|....|:          |:|:|||.||.:|....|.|||:|:|||...
Human    91 LMSSLR---------VPSQWQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVG 146

  Fly   159 SIMGQVFKRTGKILSLSKQQIVDCSV-SHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKG 222
            ::..|:..:|||::|||.|.:||||. .:||:||.||.:.....|:....||..|..|||.|...
Human   147 ALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQ 211

  Fly   223 KCQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSAS 287
            |||:.........:.:..||...|..::.||.:.|||::.::|...:|.||..|:|.:|.|:. :
Human   212 KCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQ-N 275

  Fly   288 VNHAMVVIGF----GKDYWILKNWWGQNWGENGYIRI--RKGVNMCGIANYAAY 335
            |||.::|:|:    ||:||::||.||.|:||.||||:  .|| |.||||::.:|
Human   276 VNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKG-NHCGIASFPSY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 14/56 (25%)
Peptidase_C1A 128..336 CDD:239068 89/215 (41%)
CTSSNP_004070.3 PTZ00203 5..326 CDD:185513 107/310 (35%)
Inhibitor_I29 28..87 CDD:214853 14/55 (25%)
Peptidase_C1 115..329 CDD:278538 89/216 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.