DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and CTSO

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001325.1 Gene:CTSO / 1519 HGNCID:2542 Length:321 Species:Homo sapiens


Alignment Length:318 Identity:95/318 - (29%)
Similarity:147/318 - (46%) Gaps:64/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 EFEKFKNNNNR-KYLRTYDEMRSYKA----------FEENFKVIEEHNQNYKEGQTSFRLKPNIF 88
            |...|:.:.|| :||.:.....:..|          |.|.||.|            ..|.||:.|
Human    40 EAAAFRESLNRHRYLNSLFPSENSTAFYGINQFSYLFPEEFKAI------------YLRSKPSKF 92

  Fly    89 ADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYA 153
            ...|.:.::             |..|:          ::|...|||.|..:|...||..||.|:|
Human    93 PRYSAEVHM-------------SIPNV----------SLPLRFDWRDKQVVTQVRNQQMCGGCWA 134

  Fly   154 FSIAESIMGQVFKRTGKIL-SLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTG-GIMRDQDYP 216
            ||:..:: ...:...||.| .||.||::||  |:.|.||.|||..|.|::|.... .:::|.:||
Human   135 FSVVGAV-ESAYAIKGKPLEDLSVQQVIDC--SYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYP 196

  Fly   217 YVARKGKCQFV----PDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGI 277
            :.|:.|.|.:.    ...|:...:::......||.|  .|:...||:.:.::|  .::|.|..||
Human   197 FKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMA--KALLTFGPLVVIVDA--VSWQDYLGGI 257

  Fly   278 YDDPLCSSASVNHAMVVIGFGK----DYWILKNWWGQNWGENGYIRIRKGVNMCGIAN 331
            .... |||...|||:::.||.|    .|||::|.||.:||.:||..::.|.|:||||:
Human   258 IQHH-CSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIAD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 16/70 (23%)
Peptidase_C1A 128..336 CDD:239068 76/214 (36%)
CTSONP_001325.1 Peptidase_C1A 109..319 CDD:239068 76/214 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.