DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctsc

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus


Alignment Length:370 Identity:105/370 - (28%)
Similarity:164/370 - (44%) Gaps:85/370 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFK------NNNNRKYLRTYDEMRSYKAFEENFK 65
            :.|..|   :.|.|::.:.|.::|:.....|::.      |:|..|.:.|..:..:..|::|..|
Mouse   134 WACFVG---KKVESHIEKVNMNAAHLGGLQERYSERLYTHNHNFVKAINTVQKSWTATAYKEYEK 195

  Fly    66 V-IEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPE 129
            : :.:..:.....|...|.||   |.| ||...:..|                        |:||
Mouse   196 MSLRDLIRRSGHSQRIPRPKP---APM-TDEIQQQIL------------------------NLPE 232

  Fly   130 SLDWRS---KGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILS-------LSKQQIVDCSV 184
            |.|||:   ..:::|..||.||||||:|    :.||.:..|. :||:       ||.|::|.||.
Mouse   233 SWDWRNVQGVNYVSPVRNQESCGSCYSF----ASMGMLEARI-RILTNNSQTPILSPQEVVSCSP 292

  Fly   185 SHGNQGCVGGSLRNTLSYL-----QSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVR 244
            .  .|||.||     ..||     ....|::.:..:||.|:...|:  |..:.:...|.....|.
Mouse   293 Y--AQGCDGG-----FPYLIAGKYAQDFGVVEESCFPYTAKDSPCK--PRENCLRYYSSDYYYVG 348

  Fly   245 ------DEQAIQAAVTHIGPVAISINASPKTFQLYSDGIY-----DDPLCSSASVNHAMVVIGFG 298
                  :|..::..:...||:|::.... ..|..|..|||     .||.......|||::::|:|
Mouse   349 GFYGGCNEALMKLELVKHGPMAVAFEVH-DDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYG 412

  Fly   299 KD------YWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYAI 337
            :|      |||:||.||.||||:||.|||:|.:.|.|.:.|..||
Mouse   413 RDPVTGIEYWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 16/66 (24%)
Peptidase_C1A 128..336 CDD:239068 79/239 (33%)
CtscNP_034112.3 CathepsinC_exc 26..138 CDD:285926 1/3 (33%)
Pox_I6 168..>204 CDD:252691 7/35 (20%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.