DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CtsL4 and Ctsc

DIOPT Version :10

Sequence 1:NP_609387.1 Gene:CtsL4 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_034112.3 Gene:Ctsc / 13032 MGIID:109553 Length:462 Species:Mus musculus


Alignment Length:33 Identity:9/33 - (27%)
Similarity:14/33 - (42%) Gaps:8/33 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NESLAAL------CLEKTPPFHK--WYFETRGR 56
            ||.|.:|      .|.:..||..  |:...:|:
Mouse   190 NEGLRSLWRGWGPTLLRDVPFSAMYWFNYEKGK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsL4NP_609387.1 Inhibitor_I29 36..96 CDD:462410 6/29 (21%)
Peptidase_C1A 128..336 CDD:239068
CtscNP_034112.3 CathepsinC_exc 25..138 CDD:462598
Pox_I6 168..>204 CDD:333259 4/13 (31%)
Peptidase_C1A_CathepsinC 230..459 CDD:239112
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.