DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctla2b

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_031823.1 Gene:Ctla2b / 13025 MGIID:88555 Length:113 Species:Mus musculus


Alignment Length:121 Identity:32/121 - (26%)
Similarity:60/121 - (49%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYK-AFEENFKVIEEHNQNYKEGQTSFRLKP 85
            :|...|...:..:|::::|....:.|  :.||.|..: .:|||.|.||.||.:|:.|:|||.:..
Mouse     2 MSAAPSPDPSLDNEWKEWKTTFAKAY--SLDEERHRRLMWEENKKKIEAHNADYERGKTSFYMGL 64

  Fly    86 NIFADMSTDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITP 141
            |.|:|::.:.:        ::|...|:....|     :..::||..|.....::||
Mouse    65 NQFSDLTPEEF--------RTNCCGSSMCRGE-----MAPDLPEYEDLGKNSYLTP 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 21/60 (35%)
Peptidase_C1A 128..336 CDD:239068 5/14 (36%)
Ctla2bNP_031823.1 2 X 3 AA tandem repeats of E-W-K 15..20 1/4 (25%)
Inhibitor_I29 16..74 CDD:214853 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.