DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and CTSC

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001805.4 Gene:CTSC / 1075 HGNCID:2528 Length:463 Species:Homo sapiens


Alignment Length:368 Identity:101/368 - (27%)
Similarity:160/368 - (43%) Gaps:82/368 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHN 71
            :.|..|......:.|:   ..:.|:.|:..||:   :||.|...::.:::..|.::::..     
Human   134 WACFTGKKVGTASENV---YVNIAHLKNSQEKY---SNRLYKYDHNFVKAINAIQKSWTA----- 187

  Fly    72 QNYKEGQTSFRLKPNIFADM--STDGYLKGFLRLLKSNIEDSADNMAEIVGSPLMANVPESLDWR 134
            ..|.|.:|.      ...||  .:.|:.:...|      ...|...|||  ...:.::|.|.|||
Human   188 TTYMEYETL------TLGDMIRRSGGHSRKIPR------PKPAPLTAEI--QQKILHLPTSWDWR 238

  Fly   135 SK---GFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILS-------LSKQQIVDCSVSHGNQ 189
            :.   .|::|..||.||||||:|    :.||.:..|. :||:       ||.|::|.|  |...|
Human   239 NVHGINFVSPVRNQASCGSCYSF----ASMGMLEARI-RILTNNSQTPILSPQEVVSC--SQYAQ 296

  Fly   190 GCVGGSLRNTLSYL-----QSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSW----AILPVRD 245
            ||.||     ..||     ....|::.:..:||......|:...|......:.:    ......:
Human   297 GCEGG-----FPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSSEYHYVGGFYGGCN 356

  Fly   246 EQAIQAAVTHIGPVAISINASPKTFQLYSD------GIYD-----DPLCSSASVNHAMVVIGF-- 297
            |..::..:.|.||:|::       |::|.|      |||.     ||.......|||::::|:  
Human   357 EALMKLELVHHGPMAVA-------FEVYDDFLHYKKGIYHHTGLRDPFNPFELTNHAVLLVGYGT 414

  Fly   298 ----GKDYWILKNWWGQNWGENGYIRIRKGVNMCGIANYAAYA 336
                |.||||:||.||..||||||.|||:|.:.|.|.:.|..|
Human   415 DSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAA 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 11/61 (18%)
Peptidase_C1A 128..336 CDD:239068 78/243 (32%)
CTSCNP_001805.4 CathepsinC_exc 26..138 CDD:312344 1/3 (33%)
Peptidase_C1A_CathepsinC 231..460 CDD:239112 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.