DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and Ctsq

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_083912.2 Gene:Ctsq / 104002 MGIID:2137385 Length:343 Species:Mus musculus


Alignment Length:311 Identity:110/311 - (35%)
Similarity:172/311 - (55%) Gaps:35/311 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSA---- 112
            :|:.....:|||.|.|:.||:....|:.::.:..|.||||:.:.::         ||...|    
Mouse    44 EEVLRRAIWEENVKRIKLHNRENSLGKNTYTMGLNGFADMTDEEFM---------NIVIGATLPV 99

  Fly   113 DNMAE-----IVGSPLMAN------VPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIMGQVFK 166
            ||..:     .:|||...:      :|:.:|||::|::|...||.:|.||:||.:..:|.||:||
Mouse   100 DNTRKSLWKRALGSPFPKSWYWKDALPKFVDWRNEGYVTRVRNQRNCNSCWAFPVTGAIEGQMFK 164

  Fly   167 RTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQFVPDLS 231
            :|||::.||.|.:||||...||:||..|:..|...|:...||:.....|||..::|.|::.|..|
Mouse   165 KTGKLIPLSVQNLVDCSRPQGNRGCRWGNTYNGFQYVLHNGGLEAQATYPYEGKEGLCRYNPKNS 229

  Fly   232 VVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIG 296
            ...:|.:.:|| ..|..:..||...||:|..|:....:|:.|..|:|.:|.|:| |||||:::||
Mouse   230 AAKITGFVVLP-ESEDVLMDAVATKGPIATGIHVVSSSFRFYDGGVYYEPNCTS-SVNHAVLIIG 292

  Fly   297 F--------GKDYWILKNWWGQNWGENGYIRIRKG-VNMCGIANYAAYAIV 338
            :        |.:||::||.||:.||.:||:.|.|. .|.|.||:.|.|..|
Mouse   293 YGYVGNETDGNNYWLIKNSWGRRWGLSGYMMIAKDRNNHCAIASLAQYPTV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 14/43 (33%)
Peptidase_C1A 128..336 CDD:239068 86/216 (40%)
CtsqNP_083912.2 Inhibitor_I29 29..87 CDD:214853 14/42 (33%)
Peptidase_C1 125..342 CDD:278538 87/218 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.