DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and LOC100364523

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001316813.1 Gene:LOC100364523 / 100364523 RGDID:2320837 Length:343 Species:Rattus norvegicus


Alignment Length:357 Identity:119/357 - (33%)
Similarity:193/357 - (54%) Gaps:33/357 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWKLIFFGCLCGLNCQIVTSNLSEGNSSSANCKSEFEKFKNNNNRKYLRTY---DEMRSYKAFEE 62
            |...:|...||       ...:|..::...:...:::::|    .||.:.|   :|:.....:||
  Rat     1 MTPAVFLIILC-------VGVVSGASAFDLSLDVQWQEWK----MKYEKLYSPEEELLKRVVWEE 54

  Fly    63 NFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDGYLKGFLRLLKSNIEDSADNM-AEIVGSPLMAN 126
            |.|.||.||:....|:.::.::.|.|||: ||...|..:..:...|.::..:: ...:||.|..:
  Rat    55 NVKKIELHNRENSLGKNTYIMEINDFADL-TDEEFKDMITGITLPINNTMKSLWKRALGSSLPNS 118

  Fly   127 ------VPESLDWRSKGFITPPYNQLSCGSCYAFSIAESIMGQVFKRTGKILSLSKQQIVDCSVS 185
                  :|:.:|||.:|::|....|..|.||:||.:..:|.||:||:|||:..||.|.:||||..
  Rat   119 WYWRDALPKFVDWRKEGYVTHVRVQGRCNSCWAFPVVGAIEGQMFKKTGKLTPLSVQNLVDCSKP 183

  Fly   186 HGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQFVPDLSVVNVTSWAILPVRDEQAIQ 250
            .||:||.||:..|...|:...||:..:..|||..::|.|::.|:.|...:|.:..|| .:|..:.
  Rat   184 QGNKGCRGGTTYNAFQYVLQNGGLESEATYPYEGKEGLCRYNPNNSSAKITRFVALP-ENEDVLM 247

  Fly   251 AAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASVNHAMVVIGF--------GKDYWILKNW 307
            .||...||||..|:....:.:.|..|||.:|.|:: .||||::|:|:        |.:||:::|.
  Rat   248 DAVATKGPVAAGIHVVHSSLRFYKKGIYHEPKCNN-YVNHAVLVVGYGFEGNETDGNNYWLIQNS 311

  Fly   308 WGQNWGENGYIRIRKG-VNMCGIANYAAYAIV 338
            ||:.||.|||::|.|. .|.||||.:|.|.||
  Rat   312 WGERWGLNGYMKIAKDRNNHCGIATFAQYPIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 20/62 (32%)
Peptidase_C1A 128..336 CDD:239068 86/216 (40%)
LOC100364523NP_001316813.1 Inhibitor_I29 29..87 CDD:214853 20/62 (32%)
Peptidase_C1A 126..341 CDD:239068 86/216 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.