powered by:
Protein Alignment CG5367 and LOC100332358
DIOPT Version :9
Sequence 1: | NP_609387.1 |
Gene: | CG5367 / 34401 |
FlyBaseID: | FBgn0032228 |
Length: | 338 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021333584.1 |
Gene: | LOC100332358 / 100332358 |
-ID: | - |
Length: | 258 |
Species: | Danio rerio |
Alignment Length: | 60 |
Identity: | 15/60 - (25%) |
Similarity: | 22/60 - (36%) |
Gaps: | 3/60 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 FEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQ---NYKEGQTSFRLKPNIFADMS 92
|..||...||:|....:.......|...|:.:..:|: .|..|...|..|....|.|:
Zfish 186 FSPFKEKFNRQYESEKEHEERENLFLHTFRFVHSNNRAGLTYSVGINHFADKKKELARMT 245
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4870 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1275401at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.