DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and LOC100332358

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_021333584.1 Gene:LOC100332358 / 100332358 -ID:- Length:258 Species:Danio rerio


Alignment Length:60 Identity:15/60 - (25%)
Similarity:22/60 - (36%) Gaps:3/60 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FEKFKNNNNRKYLRTYDEMRSYKAFEENFKVIEEHNQ---NYKEGQTSFRLKPNIFADMS 92
            |..||...||:|....:.......|...|:.:..:|:   .|..|...|..|....|.|:
Zfish   186 FSPFKEKFNRQYESEKEHEERENLFLHTFRFVHSNNRAGLTYSVGINHFADKKKELARMT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 15/60 (25%)
Peptidase_C1A 128..336 CDD:239068
LOC100332358XP_021333584.1 Inhibitor_I29 186..240 CDD:214853 13/53 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.