DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5367 and ctsz

DIOPT Version :9

Sequence 1:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001106427.1 Gene:ctsz / 100127597 XenbaseID:XB-GENE-959211 Length:296 Species:Xenopus tropicalis


Alignment Length:227 Identity:69/227 - (30%)
Similarity:105/227 - (46%) Gaps:39/227 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MANVPESLDWRS---KGFITPPYNQ---LSCGSCYAFSIAESIMGQV-FKRTGKILS--LSKQQI 179
            ::.:|:..|||:   ..:::...||   ..||||:|.....::..:: .||.|...|  ||.|.:
 Frog    50 VSELPKVWDWRNLNGTNYVSTTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGVWPSAYLSVQHV 114

  Fly   180 VDCSVSHGNQG-CVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGKCQ----------FVPDLSVV 233
            :||:    |.| |.||.......|..| .||..:....|.||..||.          |.....:.
 Frog   115 IDCA----NAGSCEGGDHGGVWEYANS-HGIPDETCNNYQARDQKCDKFNQCGTCVTFGKCFYLS 174

  Fly   234 NVTSWAI---LPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDD--PLCSSASVNHAMV 293
            |.|.|.:   ..|...:.:.|.:...||::..|.|:.| ...|:.|:|.:  |   ||.:||.:.
 Frog   175 NYTLWKVGDFGSVSGREKMMAEIYKNGPISCGIMATEK-LDAYTGGLYAEYQP---SAMINHIVS 235

  Fly   294 VIGFGKD-----YWILKNWWGQNWGENGYIRI 320
            |.|:|.|     |||::|.||:.|||.|::||
 Frog   236 VAGWGLDESGAEYWIVRNSWGEPWGERGWLRI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458
Peptidase_C1A 128..336 CDD:239068 69/223 (31%)
ctszNP_001106427.1 Peptidase_C1A_CathepsinX 53..294 CDD:239149 69/224 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.