DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5022 and CG12075

DIOPT Version :9

Sequence 1:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001245582.1 Gene:CG12075 / 31815 FlyBaseID:FBgn0030065 Length:1006 Species:Drosophila melanogaster


Alignment Length:254 Identity:58/254 - (22%)
Similarity:85/254 - (33%) Gaps:50/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 DASR--EPKKHTV-----GFKCPTGAACRYLWRCAIEQMLFFTLPNSQSAAVISGGGFFSWGTK- 315
            |.||  ||.|.|:     |.|...||:...:...||...:   ..:...|.|:.   .::..|| 
  Fly    42 DRSRGQEPLKVTLQVSHKGIKIVQGASKHLIPHSAITSSV---QTDDIVACVLL---LYNPATKC 100

  Fly   316 ------FRYTGRTEREILTENINALREQKNNSNSSKRKASSVPATPSSPQGDLAQIRYSSLPRST 374
                  :|....|..|.|...:..|..:.:|....:...:.:...|..|.....:.|:.|..:|:
  Fly   101 PLHVHAYRCDSETTAEALHLQLQILINRPDNQKRFEELETRLGILPPIPMNGSNEKRHESNGKSS 165

  Fly   375 MSEPLGYGMPNGHFYGHDHGM-SDANGGIQISSLEPVCEEARLRSSNIDGVNYLASQIGGYAYRD 438
            .|...|   |..|   |.|.: |..:||.:...........|..||       |.|..|. :.|:
  Fly   166 SSGGTG---PGSH---HHHQLQSQTSGGYREGRRHETSSPKRFSSS-------LGSDTGN-STRE 216

  Fly   439 SVEHSSTESGLTV-------------NGYDHPRKHNEARQHGSYSPNLYYGQSDGAVNS 484
            |  ..|.|.||..             |...||..|.....|..:.|.|...|:....:|
  Fly   217 S--ECSEEHGLVAGGSSPVSRSPPHGNSKSHPHAHPHHPPHSLHHPPLTPQQNSDLFDS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5022NP_609384.1 B41 13..205 CDD:214604
FERM_N 16..80 CDD:286467
FERM_M 108..205 CDD:278785
FERM_C_FRMD3_FRMD5 186..294 CDD:270013 13/41 (32%)
FA 308..349 CDD:285894 8/47 (17%)
CG12075NP_001245582.1 PTB 12..120 CDD:269911 21/83 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.