DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5022 and Epb41l2

DIOPT Version :9

Sequence 1:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_017445330.1 Gene:Epb41l2 / 309557 RGDID:1563977 Length:1101 Species:Rattus norvegicus


Alignment Length:427 Identity:128/427 - (29%)
Similarity:207/427 - (48%) Gaps:25/427 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SKNEGNIVYKCTVRLLDDSDVLECEFQPFHKGIYLLEYLCGELEIKEKDYFGLRYVDSSKQRHWL 68
            :|....::.|.|  |||.:: ..|:.:...||..|.:.:|..|.:.|||||||.:.:..:|::||
  Rat   207 AKKTKTVLAKVT--LLDGTE-FSCDLEKRAKGQALFDRVCEHLNLLEKDYFGLIFQEHPEQKNWL 268

  Fly    69 DLSKSIIKQCKEMDPLLFSLRVKFYPADPFRLTGN-ARIMLYQQLKRDLRHGRLYCSLGEAAALG 132
            |.:|.|.:|.:.: |.||:..|||||.||.:||.: .|..|..||::|:..|||.||....|.||
  Rat   269 DPAKEIKRQLRSL-PWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDISSGRLPCSFVTHALLG 332

  Fly   133 ALIVQEELGDYNEDVHVGSYVSSIELALRQTECLEKKIIELHKKREPGQNLSLAMDEFLGIARGL 197
            :..:|.|.|||:.:.:....:...:.|....:.||:|:.||||... |.:.:.|..:||..|:.|
  Rat   333 SYTLQAEHGDYDPEEYDSIDLGDFQFAPTHNKELEEKVAELHKTHR-GLSPAQADSQFLENAKRL 396

  Fly   198 ETYGIDPHPVKDHRGSQQYVGINNTGISTFVAGKRSQHFRWNEIHKINFEGKMFIAHLSYTDASR 262
            ..||:|.|..||..|....:|:...|:..:....|...|.|.:|.||:::...|  ::.......
  Rat   397 SMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNF--YIKVRPGEL 459

  Fly   263 EPKKHTVGFKCPTGAACRYLWRCAIEQMLFFTLPNSQSAAVISGGGFFSWGTKFRYTGRTEREIL 327
            |..:.|:|||.|...|.:.||:..:|...|:.|.:.:......   |.:.|:||||:|||:.:  
  Rat   460 EQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKTK---FLTLGSKFRYSGRTQAQ-- 519

  Fly   328 TENINALREQ---KNNSNSSKRKASSVPATPSSPQGDLAQIRYSSLPRSTMSEPLGYG-MPNGHF 388
            |...:.|.::   :....||||.:.|:   ..:|.|.:.|......|     .|.|.| :|....
  Rat   520 TREASTLIDRPAPQFERASSKRVSRSL---DGAPIGVVDQSLMKDFP-----GPPGEGSVPGPGV 576

  Fly   389 YGHDHGMSDANGGIQISSLEPVCEEARLRSSNIDGVN 425
            ..:.........|...:.:.|:..|.:..:..:||.|
  Rat   577 VSYTTVQDGRRDGKSPTKVTPLLAEGKKNTLRVDGDN 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5022NP_609384.1 B41 13..205 CDD:214604 72/192 (38%)
FERM_N 16..80 CDD:286467 23/63 (37%)
FERM_M 108..205 CDD:278785 34/96 (35%)
FERM_C_FRMD3_FRMD5 186..294 CDD:270013 32/107 (30%)
FA 308..349 CDD:285894 15/43 (35%)
Epb41l2XP_017445330.1 PTZ00121 <4..>216 CDD:173412 1/8 (13%)
B41 215..404 CDD:214604 72/193 (37%)
FERM_C_4_1_family 399..492 CDD:270005 27/94 (29%)
FA 502..545 CDD:400882 15/47 (32%)
SAB 622..662 CDD:398195
4_1_CTD 989..1094 CDD:399118
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.