DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5022 and LOC298139

DIOPT Version :9

Sequence 1:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001013952.1 Gene:LOC298139 / 298139 RGDID:1359584 Length:217 Species:Rattus norvegicus


Alignment Length:83 Identity:18/83 - (21%)
Similarity:32/83 - (38%) Gaps:21/83 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NEGNIVYKCTVRLL---DDSDVLECEFQPFHKGIYLLEYLCGELEIKEKDYFGLRYVDSSKQRHW 67
            :|.:|::.|..|.:   :|:|:.|                  |||..|..:.........:.|..
  Rat   103 DEVDILFDCPSRFVLEREDTDLFE------------------ELEADENTFLMTEEEKVKEARQA 149

  Fly    68 LDLSKSIIKQCKEMDPLL 85
            |..|.||:.....::||:
  Rat   150 LSWSYSILTGRIWLNPLV 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5022NP_609384.1 B41 13..205 CDD:214604 16/76 (21%)
FERM_N 16..80 CDD:286467 13/66 (20%)
FERM_M 108..205 CDD:278785
FERM_C_FRMD3_FRMD5 186..294 CDD:270013
FA 308..349 CDD:285894
LOC298139NP_001013952.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345141
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.