DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5022 and EPB41L1

DIOPT Version :9

Sequence 1:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster
Sequence 2:XP_011526969.1 Gene:EPB41L1 / 2036 HGNCID:3378 Length:1585 Species:Homo sapiens


Alignment Length:419 Identity:148/419 - (35%)
Similarity:205/419 - (48%) Gaps:49/419 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YK---CTVRLLDDSDVLECEFQPFHKGIYLLEYLCGELEIKEKDYFGLRYVDSSKQRHWLDLSKS 73
            ||   |.|.|||.|: .|||.:...:|..|.:.:|..|.:.|||||||.:.|:..|::|||.||.
Human   119 YKSAICRVTLLDASE-YECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKE 182

  Fly    74 IIKQCKEMDPLLFSLRVKFYPADPFRLTGN-ARIMLYQQLKRDLRHGRLYCSLGEAAALGALIVQ 137
            |.||.:. .|..|:..|||||.||.:||.: .|..|..||:.|:..|||.||....|.||:..||
Human   183 IKKQIRS-SPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQ 246

  Fly   138 EELGDYNEDVHVGSYVSSIELALRQTECLEKKIIELHKK---REPGQNLSLAMDEFLGIARGLET 199
            .|||||:.:.|||:|||.:..|..||..||::|:||||.   ..||:    |...||..|:.|..
Human   247 AELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGE----AEIHFLENAKKLSM 307

  Fly   200 YGIDPHPVKDHRGSQQYVGINNTGISTFVAGKRSQHFRWNEIHKINFEGKMFIAHLSYTDASREP 264
            ||:|.|..||..|....:|:...|:..:....|...|.|.:|.||:::...|  ::.......|.
Human   308 YGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNF--YIKIRPGEYEQ 370

  Fly   265 KKHTVGFKCPTGAACRYLWRCAIEQMLFFTLPNSQSAAVISGGGFFSWGTKFRYTGRTEREILTE 329
            .:.|:|||.|...:.:.||:..||...||.|.:.:...    .||...|:||||:|||:.:  |.
Human   371 FESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPP----KGFLVMGSKFRYSGRTQAQ--TR 429

  Fly   330 NINALREQKN---NSNSSKRKASSVPATPSSPQGDLAQIRYSSLPRSTMSEPLGYGMPNGHFYGH 391
            ..:||.::..   ..:||||...|                 .||..:..|.|.  .:...|..|.
Human   430 QASALIDRPAPFFERSSSKRYTMS-----------------RSLDGAEFSRPA--SVSENHDAGP 475

  Fly   392 DHGMSDANG--GIQISSLEPVCEEARLRS 418
            |....|.:|  |.|.|.    .||..:|:
Human   476 DGDKRDEDGESGGQRSE----AEEGEVRT 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5022NP_609384.1 B41 13..205 CDD:214604 88/198 (44%)
FERM_N 16..80 CDD:286467 29/63 (46%)
FERM_M 108..205 CDD:278785 45/99 (45%)
FERM_C_FRMD3_FRMD5 186..294 CDD:270013 32/107 (30%)
FA 308..349 CDD:285894 17/43 (40%)
EPB41L1XP_011526969.1 B41 124..313 CDD:214604 87/194 (45%)
FERM_N 126..189 CDD:286467 29/63 (46%)
FERM_M 208..313 CDD:278785 48/108 (44%)
FERM_C_4_1_family 308..401 CDD:270005 28/94 (30%)
FA 410..450 CDD:285894 16/41 (39%)
SAB 518..>549 CDD:282265
4_1_CTD <1495..1572 CDD:283537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151646
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.