DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5022 and M88.4

DIOPT Version :9

Sequence 1:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_497922.2 Gene:M88.4 / 175594 WormBaseID:WBGene00010907 Length:365 Species:Caenorhabditis elegans


Alignment Length:212 Identity:41/212 - (19%)
Similarity:67/212 - (31%) Gaps:68/212 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 ISGGGFFSWGTKFRYTGRTE--------------REILTENINALREQKNNSNSSK--RKASSVP 352
            |:...|:.|     |.|..|              |::|.|:......:.....|||  :...|||
 Worm     9 IAKSHFYVW-----YLGSKEADGVRGSAVVLPVMRQLLKESFKKTPSKATVQISSKGLKLIQSVP 68

  Fly   353 ATPSSPQGDLAQIR---------YSSLPRSTMSEPLGYGM----PNGHFYGHDHGMSDANGGIQI 404
            |...|.:..:..::         ||...::...:.:|..|    |......|.|...        
 Worm    69 AMSRSGKVKMQLVKFQIAANCITYSITGKAPFDDVVGVVMLVLNPEMQSPMHVHCYR-------- 125

  Fly   405 SSLEPVCEEARLRSSNIDGVNYLASQIGGYAYRDSVEHSSTESGLTVNGYDHPRKHNEARQHGSY 469
                  |:.|......:..:..|.|:.......:.:||....|||.|     ||.:|        
 Worm   126 ------CDSAETAQIMLANLQLLLSRPDVQRSINDLEHRLFLSGLLV-----PRNNN-------- 171

  Fly   470 SPNLYYGQSDGAVNSSS 486
                   .|:|:||.::
 Worm   172 -------NSEGSVNQNA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5022NP_609384.1 B41 13..205 CDD:214604
FERM_N 16..80 CDD:286467
FERM_M 108..205 CDD:278785
FERM_C_FRMD3_FRMD5 186..294 CDD:270013
FA 308..349 CDD:285894 11/56 (20%)
M88.4NP_497922.2 PTB 13..152 CDD:214675 27/157 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.