DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5022 and nploc4

DIOPT Version :9

Sequence 1:NP_609384.1 Gene:CG5022 / 34398 FlyBaseID:FBgn0032225 Length:572 Species:Drosophila melanogaster
Sequence 2:NP_001135712.1 Gene:nploc4 / 100216289 XenbaseID:XB-GENE-958208 Length:610 Species:Xenopus tropicalis


Alignment Length:316 Identity:68/316 - (21%)
Similarity:100/316 - (31%) Gaps:113/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FRSKNEGNIVYKCTVRLLDDSDVLECEFQPFHKGIYLLEYLCGELEIKEKDYFGLRYVDS----- 61
            :.||.:|.| |:       :.|...|...|..|.::     |..||..::||  |.::|.     
 Frog   115 YLSKQDGKI-YR-------NRDPQLCRHGPLGKCVH-----CVPLEPFDEDY--LNHLDPPVKHM 164

  Fly    62 ------SKQRHWLDLSKSI--------IKQ------------CKEMDPLLFSLRVKFYP------ 94
                  .|.....|..|.:        ||.            |.:..|...:|..:.|.      
 Frog   165 SFHANIRKLTGGADKGKFVALENISCKIKSGCEGHPPWPEGICTKCQPSAITLNRQKYRHVDNIM 229

  Fly    95 ------ADPF----RLTGNARIMLYQQLKRDLRHGRLY--------CSLGEAAALGALIVQEELG 141
                  ||.|    |.|||.||            |.||        ..||..|.:.|:....::|
 Frog   230 FENHTIADRFLDFWRKTGNQRI------------GYLYGRYTEHKDIPLGLRAEVAAIYEPPQIG 282

  Fly   142 DYNE----DVHVGSYVSSI--ELALRQTECLEKKIIELHKKREPGQNLSLAMDEFLGIARGLETY 200
            ..|.    |......|..|  :|.||:...:...::. ...|:.....|...|.:...|....|.
 Frog   283 TQNSLQLLDDPKAKVVDEIAAKLGLRKVGWIFTDLVS-EDTRKGTVRYSRNKDTYFLSAEECITS 346

  Fly   201 GI--DPHP------VKDHRGSQQYVGINNTGISTFVAGKRSQHFRWNEIHKINFEG 248
            |.  :.||      ...|.|| ::|.:..||      |..:|         ::|||
 Frog   347 GFFQNKHPNLCRLSPDGHFGS-KFVTVVATG------GPDNQ---------VHFEG 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5022NP_609384.1 B41 13..205 CDD:214604 50/254 (20%)
FERM_N 16..80 CDD:286467 17/94 (18%)
FERM_M 108..205 CDD:278785 21/112 (19%)
FERM_C_FRMD3_FRMD5 186..294 CDD:270013 17/71 (24%)
FA 308..349 CDD:285894
nploc4NP_001135712.1 UN_NPL4 1..80 CDD:338032
zf-NPL4 107..247 CDD:368244 29/146 (20%)
NPL4 250..558 CDD:368245 36/166 (22%)
RanBP2-type Zn finger 586..605 CDD:275376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3530
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.