DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and ECM23

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_015304.1 Gene:ECM23 / 856086 SGDID:S000005942 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:156 Identity:31/156 - (19%)
Similarity:55/156 - (35%) Gaps:45/156 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   623 LKDLSEAQSSKSK-------PCRRKQSFPTKTDCIDVVNENVTDTYTTSEATPDDKKDKRNINLF 680
            :|.|:.|.|.|.|       |.......|..:.....::.|  ...:.:...|..:| |:.|   
Yeast    65 IKSLNSALSPKLKEESRLGGPLHNPSILPAPSFSSLPISSN--GKKSLAGYRPKSRK-KQTI--- 123

  Fly   681 NAIPGAQKDMSCSNCGTLTTTIWRRSVRGEM-VCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPK 744
              :|..| ...|:.||...|:.||....|.: :|:.||:.::                       
Yeast   124 --LPNGQ-PKECATCGDTWTSQWRSGPNGNVELCSRCGIAYR----------------------- 162

  Fly   745 ELERSKKKHKQMSSCSSIETTKQDFL 770
                 ||..|::.|..|.:...::|:
Yeast   163 -----KKMEKKIRSQQSSDDGTKNFI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 10/48 (21%)
ZnF_GATA 691..742 CDD:238123 10/51 (20%)
ECM23NP_015304.1 ZnF_GATA 127..178 CDD:214648 16/79 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.