DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and DAL80

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_012959.1 Gene:DAL80 / 853904 SGDID:S000001742 Length:269 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:49/174 - (28%)
Similarity:82/174 - (47%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   691 SCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERS------ 749
            :|.||.|:.|.:|||...|.::||||||:.||||..||.|::.|||.:|.|  |:|..:      
Yeast    30 TCQNCFTVKTPLWRRDEHGTVLCNACGLFLKLHGEPRPISLKTDTIKSRNR--KKLNNNNVNTNA 92

  Fly   750 -----------KKKHKQMSSCSSIETTKQDFLTARESLAISGLV--LNKFKKEIDDTETPAAAAL 801
                       |:|.:.:::......|....::..|...:||.:  |.|.|:.:.:|        
Yeast    93 NTHSNDPNKIFKRKKRLLTTGGGSLPTNNPKVSILEKFMVSGSIKPLLKPKETVPNT-------- 149

  Fly   802 KDILSRRKKSNSLPAFNDTCESADLSAPLNLVSSE---NNAKLT 842
            |:..::|.|.:.     |.||.:..:....:..|:   :|.:||
Yeast   150 KECSTQRGKFSL-----DPCEPSGKNYLYQINGSDIYTSNIELT 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 23/44 (52%)
ZnF_GATA 691..742 CDD:238123 26/50 (52%)
DAL80NP_012959.1 GAT1 <1..269 CDD:227928 49/174 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341364
Domainoid 1 1.000 54 1.000 Domainoid score I2764
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16864
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.