DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and ARR7

DIOPT Version :10

Sequence 1:NP_609383.2 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_173339.1 Gene:ARR7 / 838487 AraportID:AT1G19050 Length:206 Species:Arabidopsis thaliana


Alignment Length:187 Identity:42/187 - (22%)
Similarity:78/187 - (41%) Gaps:35/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   292 LRPDPNDLETK-LDAILKASSEAIAAKALTELSTFSKVKY---DHSKLDSSIQPGLDRKIE--IS 350
            |..|.:.::.| ::.:|:.||    .|..|..|....::|   |..|..|:::   |.|:.  ::
plant    27 LAVDDSIVDRKVIERLLRISS----CKVTTVESGTRALQYLGLDGGKGASNLK---DLKVNLIVT 84

  Fly   351 NQEMPAHSLYPSLFKSITMKSDQKSKAMSGSSHS--------------QFDSKLQKDSDIEKYEN 401
            :..||..|.|..|.|.....:.::...:..||.:              :|..|..|.:|:::.:.
plant    85 DYSMPGLSGYDLLKKIKESSAFREVPVVIMSSENILPRIQECLKEGAEEFLLKPVKLADVKRIKQ 149

  Fly   402 L--QQQLETAAVLMDISKKIVISPPCSNPQSPCFSAAVDTSIKSSVIKSKRPSNQNE 456
            |  :.:.|...:|...:|:     ..........|:..|||||.|.. |||..:::|
plant   150 LIMRNEAEECKILSHSNKR-----KLQEDSDTSSSSHDDTSIKDSSC-SKRMKSESE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_609383.2 zf-AD <228..284 CDD:214871
GAT1 625..>742 CDD:227928
ZnF_GATA 691..742 CDD:238123
ARR7NP_173339.1 REC_typeA_ARR 26..147 CDD:381119 27/126 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.