DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and RR23

DIOPT Version :10

Sequence 1:NP_609383.2 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_201018.1 Gene:RR23 / 836332 AraportID:AT5G62120 Length:145 Species:Arabidopsis thaliana


Alignment Length:109 Identity:21/109 - (19%)
Similarity:39/109 - (35%) Gaps:40/109 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 DSSSPHLTFQIFNCLSIKALPNDGLPNVVCGDCRQKLDS-------FEKFRTMAH---------- 276
            |||.|..|...||.:.: .:.:..:|.:.....::::|.       .:.:|.:.|          
plant     5 DSSEPVTTLTQFNNIDV-VITDYHMPGLNGVQLKKRIDEEFGNLPVIDLYRNIEHEELFRRALCF 68

  Fly   277 ----------NS-----QIALKEFLN-------ISKNLRPDPND 298
                      ||     |.||:..:|       ..:|:..||:|
plant    69 MHKPISRRDLNSLNVVCQQALRHRMNGETNLNGSGQNVTDDPDD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_609383.2 zf-AD <228..284 CDD:214871 16/86 (19%)
GAT1 625..>742 CDD:227928
ZnF_GATA 691..742 CDD:238123
RR23NP_201018.1 CheY <17..78 CDD:440547 5/61 (8%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.