DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and MNP

DIOPT Version :10

Sequence 1:NP_609383.2 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_566939.1 Gene:MNP / 824251 AraportID:AT3G50870 Length:295 Species:Arabidopsis thaliana


Alignment Length:31 Identity:16/31 - (51%)
Similarity:22/31 - (70%) Gaps:1/31 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 CSNCGTLTTTIWRRSVRG-EMVCNACGLYFK 721
            |:||.|.:|.:||...|| :.:|||||:.||
plant   154 CANCDTTSTPLWRNGPRGPKSLCNACGIRFK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_609383.2 zf-AD <228..284 CDD:214871
GAT1 625..>742 CDD:227928 16/31 (52%)
ZnF_GATA 691..742 CDD:238123 16/31 (52%)
MNPNP_566939.1 GAT1 <90..>184 CDD:227928 14/29 (48%)
ZnF_GATA 152..194 CDD:214648 16/31 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.