| Sequence 1: | NP_609383.2 | Gene: | GATAd / 34395 | FlyBaseID: | FBgn0032223 | Length: | 842 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_566939.1 | Gene: | MNP / 824251 | AraportID: | AT3G50870 | Length: | 295 | Species: | Arabidopsis thaliana |
| Alignment Length: | 31 | Identity: | 16/31 - (51%) |
|---|---|---|---|
| Similarity: | 22/31 - (70%) | Gaps: | 1/31 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 692 CSNCGTLTTTIWRRSVRG-EMVCNACGLYFK 721 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GATAd | NP_609383.2 | zf-AD | <228..284 | CDD:214871 | |
| GAT1 | 625..>742 | CDD:227928 | 16/31 (52%) | ||
| ZnF_GATA | 691..742 | CDD:238123 | 16/31 (52%) | ||
| MNP | NP_566939.1 | GAT1 | <90..>184 | CDD:227928 | 14/29 (48%) |
| ZnF_GATA | 152..194 | CDD:214648 | 16/31 (52%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||