DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and RR5

DIOPT Version :10

Sequence 1:NP_609383.2 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_190393.1 Gene:RR5 / 823965 AraportID:AT3G48100 Length:184 Species:Arabidopsis thaliana


Alignment Length:232 Identity:43/232 - (18%)
Similarity:88/232 - (37%) Gaps:63/232 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 SQIALKEFLNISKNLRPDPNDLET-KLDAILKASSEAIAAKALTELSTFSKVKYDHSKLDSSIQP 341
            :::...|.|:||.    |.:.|.: ||..:|......:..|.:..|...|..|.  :.:||:.:.
plant     2 AEVLRPEMLDISN----DTSSLASPKLLHVLAVDDSMVDRKFIERLLRVSSCKV--TVVDSATRA 60

  Fly   342 ----GLDRKIEISNQEMPAHSLYPSLFKSITMKSDQKSKAMSGSSHSQFDSKLQKDSDIEKYENL 402
                |||.:   :|..:....|..:|     :.:|.....|:|                  ||.|
plant    61 LQYLGLDGE---NNSSVGFEDLKINL-----IMTDYSMPGMTG------------------YELL 99

  Fly   403 QQQLETAA-----VLMDISKKIVISPPCSNPQSPCFSAAVDTSIKSSVIKSKRPSNQNEIQDGVE 462
            ::..|::|     |::..|:.|:          |.....::...:..::|..:.::...::|.: 
plant   100 KKIKESSAFREIPVVIMSSENIL----------PRIDRCLEEGAEDFLLKPVKLADVKRLRDSL- 153

  Fly   463 IDLSVKKQKNDYSNQRNAAPIHHFCQTPMLDIQSHLR 499
                :|.::..:.|      |.|..:....||.|.|:
plant   154 ----MKAEERAFKN------IMHKRELEANDIYSQLK 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_609383.2 zf-AD <228..284 CDD:214871 0/5 (0%)
GAT1 625..>742 CDD:227928
ZnF_GATA 691..742 CDD:238123
RR5NP_190393.1 REC_typeA_ARR 27..149 CDD:381119 26/159 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.