DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and GATA13

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_180401.2 Gene:GATA13 / 817381 AraportID:AT2G28340 Length:291 Species:Arabidopsis thaliana


Alignment Length:250 Identity:54/250 - (21%)
Similarity:100/250 - (40%) Gaps:64/250 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 EEDFQ--------NYSITINQVGGSDFKSKAPKASTGSLLDSGDSSDSHKLEMDITSSINDRKTP 557
            ||||:        |.....|.|...|.:       ||.  |.||.  ..|.:..:...:::..  
plant     9 EEDFKGLPDNFLDNLVDPTNDVSVEDIE-------TGD--DEGDW--DAKFQKLVPPPLDELM-- 60

  Fly   558 DSLSSDHATDAATTQLWQALARSAAKSKEDNPASQIFRNMMSQPFAFPVPSTVSFTKVPE--EPI 620
             |||.:...:....|:     :......:.:.:|::|..:.:.      |..|..:|:.:  .|:
plant    61 -SLSYEFTCNGQRVQV-----QKHVPILKQSSSSEVFSTVDNS------PPNVKVSKLLQSLSPV 113

  Fly   621 ALLKDLSEAQSSKS-----------KPCRRKQSFPT-------KTDCIDVVNENVTDTYTTSEAT 667
            ::||:.:.:.|.::           |..|.|:..||       |:..:::..:...|...:||.:
plant   114 SVLKNTNGSGSPQNPNGDQKLAFLVKGIRSKRKRPTLLRVTFLKSFLLEMSQQFAPDESESSEIS 178

  Fly   668 PDDKKDKRNINLFNAIPGAQKDMSCSNCGTLTTTIWRRSVRG-EMVCNACGLYFK 721
            . .||.|:|         ..:.:.|::|.|.||..||....| :.:|||||:.|:
plant   179 A-LKKRKKN---------KSRRLKCTHCETTTTPQWREGPNGRKTLCNACGIRFR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 14/34 (41%)
ZnF_GATA 691..742 CDD:238123 14/31 (45%)
GATA13NP_180401.2 ZnF_GATA 193..241 CDD:214648 14/30 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.