DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and gata4

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001016949.1 Gene:gata4 / 549703 XenbaseID:XB-GENE-487458 Length:394 Species:Xenopus tropicalis


Alignment Length:299 Identity:76/299 - (25%)
Similarity:118/299 - (39%) Gaps:106/299 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 HATDAATTQLWQALAR------------SAAKSKEDNPASQIFRNMMSQ----PFAF-------P 605
            |:..|||:.::....|            ::..|::.:|.|.  .||.:|    |.|:       |
 Frog    24 HSATAATSPVYVPTTRVSSMIPSLPYLQTSGSSQQGSPVSG--HNMWAQAGAEPSAYNPGTSHPP 86

  Fly   606 VPSTVSFTKVP------------EEPIALLKDLSEAQSSKSKPCRRKQSFPTKTDCIDVVNENVT 658
            |....:|:..|            ..|:|:..:..| |..::........:|.      .::.::.
 Frog    87 VSPRFTFSSSPPISAASNREVPYSSPLAISANGRE-QYGRALGATYSSPYPA------YMSPDMG 144

  Fly   659 DTYTTS------------EATP-----------DDKKDKRN-IN--------------------- 678
            .|:|.|            .|.|           ||..:.|. :|                     
 Frog   145 ATWTASPFDSSMLHNLQNRAGPAASRHPNIEFFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA 209

  Fly   679 --LFNAIPGAQK---------------DMSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVN 726
              |::.:.|..:               .:||:||.|.|||:|||:..||.||||||||.|||||.
 Frog   210 CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVP 274

  Fly   727 RPHSMRRDTIHTRRRRPKELERSKKKHKQMSSCSSIETT 765
            ||.:|:::.|.||:|:||.|.:||....|.||.|...:|
 Frog   275 RPLAMKKEGIQTRKRKPKNLSKSKTPTGQNSSDSLTPST 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 29/62 (47%)
ZnF_GATA 691..742 CDD:238123 32/50 (64%)
gata4NP_001016949.1 GATA-N 1..174 CDD:283099 27/158 (17%)
ZnF_GATA 181..228 CDD:214648 4/46 (9%)
ZnF_GATA 185..235 CDD:238123 3/49 (6%)
ZnF_GATA 237..284 CDD:214648 29/46 (63%)
ZnF_GATA 239..290 CDD:238123 32/50 (64%)
Peptidase_S64 293..>387 CDD:285411 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.