DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and grn

DIOPT Version :10

Sequence 1:NP_609383.2 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001262366.1 Gene:grn / 40962 FlyBaseID:FBgn0001138 Length:712 Species:Drosophila melanogaster


Alignment Length:126 Identity:23/126 - (18%)
Similarity:47/126 - (37%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VSVIGGLGVYALTNSLYNVDGGHRAVMFNRLTGIKEKVYPEGTHFMVPWFERPIIY-DVRARPYL 84
            :||.|.|........|.|:..|::|:                       :|..|:: |::.:..|
  Fly   120 ISVKGRLNPSNFRLLLDNIARGYKAL-----------------------YELKIVHRDIKPQNIL 161

  Fly    85 VESTTGSHDLQMVKIGLRVLTRPMGDRLPQIYRTLGENYSERVLPSIIHETLKAVVAQYNA 145
            :..|..|..:...:|....::|.:.:...::....|..|  .:.|.:....||  ..||::
  Fly   162 ITYTDASKQIACARITDFGISRTLDNEGEELCNVAGTFY--YMAPEVGANLLK--TCQYDS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_609383.2 zf-AD <228..284 CDD:214871
GAT1 625..>742 CDD:227928
ZnF_GATA 691..742 CDD:238123
grnNP_001262366.1 ZnF_GATA 473..517 CDD:238123
ZnF_GATA 533..583 CDD:238123
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.