DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and gata4

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_571311.2 Gene:gata4 / 30483 ZFINID:ZDB-GENE-980526-476 Length:352 Species:Danio rerio


Alignment Length:77 Identity:38/77 - (49%)
Similarity:57/77 - (74%) Gaps:1/77 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 MSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERSKKKHK 754
            :||:||.|.|||:|||:..||.||||||||.|||||.||.:|:::.|.||:|:||.:.::|....
Zfish   222 LSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNISKTKPGSS 286

  Fly   755 Q-MSSCSSIETT 765
            : .|:.|::.::
Zfish   287 EGQSAISAVNSS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 29/45 (64%)
ZnF_GATA 691..742 CDD:238123 32/50 (64%)
gata4NP_571311.2 GATA-N 1..158 CDD:283099
ZnF_GATA 165..210 CDD:214648
ZnF_GATA 169..219 CDD:238123
ZnF_GATA 221..268 CDD:214648 29/45 (64%)
ZnF_GATA 223..274 CDD:238123 32/50 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.