powered by:
Protein Alignment GATAd and gata4
DIOPT Version :9
Sequence 1: | NP_001260326.1 |
Gene: | GATAd / 34395 |
FlyBaseID: | FBgn0032223 |
Length: | 842 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571311.2 |
Gene: | gata4 / 30483 |
ZFINID: | ZDB-GENE-980526-476 |
Length: | 352 |
Species: | Danio rerio |
Alignment Length: | 77 |
Identity: | 38/77 - (49%) |
Similarity: | 57/77 - (74%) |
Gaps: | 1/77 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 690 MSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERSKKKHK 754
:||:||.|.|||:|||:..||.||||||||.|||||.||.:|:::.|.||:|:||.:.::|....
Zfish 222 LSCTNCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNISKTKPGSS 286
Fly 755 Q-MSSCSSIETT 765
: .|:.|::.::
Zfish 287 EGQSAISAVNSS 298
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000130 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10071 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.