DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and GATA6

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_005248.2 Gene:GATA6 / 2627 HGNCID:4174 Length:595 Species:Homo sapiens


Alignment Length:172 Identity:65/172 - (37%)
Similarity:89/172 - (51%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 PFAFPVPSTVSF-----TKVPEEPIA-LLKDLSEAQSSKSKPCRRKQSFPT---KTDCIDVVNEN 656
            ||..||..::..     ..||..|.| ||:||||     |:.|....|..|   :.|.......|
Human   353 PFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSE-----SRECVNCGSIQTPLWRRDGTGHYLCN 412

  Fly   657 VTDTYTTSE--ATPDDKKDKRNINLFNAIPGAQK-DMSCSNCGTLTTTIWRRSVRGEMVCNACGL 718
            ....|:...  :.|..|..||       :|.::: .:||:||.|.|||:|||:..||.|||||||
Human   413 ACGLYSKMNGLSRPLIKPQKR-------VPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGL 470

  Fly   719 YFKLHGVNRPHSMRRDTIHTRRRRPKELERSKKKHKQMSSCS 760
            |.|||||.||.:|:::.|.||:|:||.:.:||       :||
Human   471 YMKLHGVPRPLAMKKEGIQTRKRKPKNINKSK-------TCS 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 29/48 (60%)
ZnF_GATA 691..742 CDD:238123 32/50 (64%)
GATA6NP_005248.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..71
GATA-N 147..377 CDD:283099 6/23 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..255
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..339
ZnF_GATA 388..435 CDD:214648 10/53 (19%)
ZnF_GATA 389..434 CDD:238123 10/51 (20%)
ZnF_GATA 441..488 CDD:214648 29/46 (63%)
ZnF_GATA 443..494 CDD:238123 32/50 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..561 11/31 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.