DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and GATA4

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001295022.1 Gene:GATA4 / 2626 HGNCID:4173 Length:443 Species:Homo sapiens


Alignment Length:139 Identity:52/139 - (37%)
Similarity:71/139 - (51%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 KSKPCRRKQSFPTKTDCIDVVNENVTDTYTTSEATPDDKKDKRNINLFNA------IPGAQK--- 688
            ::.|..|   .|...|..|..:|........:.:||..::|.....|.||      :.|..:   
Human   195 RANPAAR---HPNLVDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNACGLYHKMNGINRPLI 256

  Fly   689 ------------DMSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRR 741
                        .:||:||.|.|||:|||:..||.||||||||.|||||.||.:||::.|.||:|
Human   257 KPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKR 321

  Fly   742 RPKELERSK 750
            :||.|.:||
Human   322 KPKNLNKSK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 30/62 (48%)
ZnF_GATA 691..742 CDD:238123 33/50 (66%)
GATA4NP_001295022.1 GATA-N 1..205 CDD:368398 3/12 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..107
ZnF_GATA 217..267 CDD:238123 7/49 (14%)
ZnF_GATA 271..322 CDD:238123 33/50 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..379 9/16 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 410..429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2600
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.