DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and med-1

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001366746.1 Gene:med-1 / 191705 WormBaseID:WBGene00003180 Length:174 Species:Caenorhabditis elegans


Alignment Length:160 Identity:41/160 - (25%)
Similarity:52/160 - (32%) Gaps:39/160 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 ASQIFRNMMSQ----PFAFPVPSTVSFTK---------------VPEEPIALLKDLSEAQSSKSK 635
            |..:|.|...|    .::.|...|.|||.               ....|.|:  |.|....|.:.
 Worm    10 AENVFDNTQQQVGFYDYSTPFNGTYSFTTDYSYYNNYYDYVNTYASYYPTAM--DSSSLNISSTT 72

  Fly   636 PCRRKQSFPTKTDCIDVVNENVTDTYTTSEATPDDKKDKRNINLFNAIPGAQKDMSCSNCGTLTT 700
            .......|.|.|..  ........|.|.|..||.:..:|             |...||||....|
 Worm    73 GSPNSSHFTTFTHF--STPSTSPSTSTQSSTTPSNSDNK-------------KSFQCSNCSVTET 122

  Fly   701 TIWR--RSVRGEMVCNACGLYFKLHGVNRP 728
            ..||  ||..| :.||||.:|.:.:...||
 Worm   123 IRWRNIRSKEG-IQCNACFIYQRKYNKTRP 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 18/43 (42%)
ZnF_GATA 691..742 CDD:238123 17/40 (43%)
med-1NP_001366746.1 ZnF_GATA 109..160 CDD:214648 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.