DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GATAd and elt-4

DIOPT Version :9

Sequence 1:	NP_001260326.1	Gene:	GATAd / 34395	FlyBaseID:	FBgn0032223	Length:	842	Species:	Drosophila melanogaster
Sequence 2:	NP_001257105.1	Gene:	elt-4 / 181249	WormBaseID:	WBGene00001252	Length:	72	Species:	Caenorhabditis elegans

Alignment Length:	51	Identity:	28/51 - (54%)
Similarity:	35/51 - (68%)	Gaps:	0/51 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   687 QKDMSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIH 737
            :|.:.||||....||:|||...|:.||||||||||||.|.||..|:::..|
Worm    11 RKRLVCSNCNGTNTTLWRRKAEGDPVCNACGLYFKLHHVTRPIPMKKNKKH 61

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GATAd	NP_001260326.1	zf-AD	<228..284	CDD:214871
		ZnF_GATA	688..736	CDD:214648	27/47 (57%)
		ZnF_GATA	691..742	CDD:238123	27/47 (57%)
elt-4	NP_001257105.1	ZnF_GATA	15..59	CDD:238123	26/43 (60%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160156187
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000130
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	4	3.840