DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and elt-7

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_504283.1 Gene:elt-7 / 178868 WormBaseID:WBGene00015981 Length:198 Species:Caenorhabditis elegans


Alignment Length:147 Identity:37/147 - (25%)
Similarity:68/147 - (46%) Gaps:22/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   601 PFAFPVPSTVSFTKVPEEPIALLKDLSEAQSSKSKPCRRKQSFPTKTDCIDVVNENVTDTYTTSE 665
            |:..|:.|::..|  |.:|:...:.:.:...:|                    |||...::...:
 Worm    74 PYEQPIQSSMCTT--PLQPLEDSRIIFDESLTK--------------------NENEQKSFVEQD 116

  Fly   666 ATPDDKKDKRNINLFNAIPGAQKDMSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHS 730
            ::.:...::........|....:|..||:|.|.|||:||::..|.:.||||.||::.:.|.||.|
 Worm   117 SSYESSGNRFGSQKGKKIAKVIRDACCSHCSTTTTTLWRKNDEGNLECNACNLYYRHNKVKRPLS 181

  Fly   731 MRRDTIHTRRRRPKELE 747
            :.:....||:||..:.|
 Worm   182 LCKQKPTTRKRRQAKKE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 21/47 (45%)
ZnF_GATA 691..742 CDD:238123 22/50 (44%)
elt-7NP_504283.1 ZnF_GATA 139..187 CDD:214648 21/47 (45%)
ZnF_GATA 143..194 CDD:238123 23/50 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.