DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GATAd and Gata5

DIOPT Version :9

Sequence 1:	NP_001260326.1	Gene:	GATAd / 34395	FlyBaseID:	FBgn0032223	Length:	842	Species:	Drosophila melanogaster
Sequence 2:	NP_032119.2	Gene:	Gata5 / 14464	MGIID:	109497	Length:	404	Species:	Mus musculus

Alignment Length:	131	Identity:	52/131 - (39%)
Similarity:	68/131 - (51%)	Gaps:	31/131 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   690 MSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERSK---- 750
            :.||||.|.|||:|||:..||.||||||||.|||||.||.:|::::|.||:|:||...:.|
Mouse   248 LCCSNCHTATTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKNPAKIKGSSG 312

  Fly   751 ----------------------KKHKQMSS--CSSIETTKQDFLTARESLAISGLVLNKFKKEID 791
                                  |....::|  |:....|.|....|.||||.|.|   :||.|.:
Mouse   313 STANTTASSPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHL---EFKFEPE 374

  Fly   792 D 792
            |
Mouse   375 D 375

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GATAd	NP_001260326.1	zf-AD	<228..284	CDD:214871
		ZnF_GATA	688..736	CDD:214648	29/45 (64%)
		ZnF_GATA	691..742	CDD:238123	32/50 (64%)
Gata5	NP_032119.2	GATA-N	1..181	CDD:368398
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	71..112
		ZnF_GATA	195..239	CDD:238123
		ZnF_GATA	250..300	CDD:238123	32/49 (65%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	293..332		7/38 (18%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5641
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000130
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10071
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.910