powered by:
Protein Alignment GATAd and Gata4
DIOPT Version :9
Sequence 1: | NP_001260326.1 |
Gene: | GATAd / 34395 |
FlyBaseID: | FBgn0032223 |
Length: | 842 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001297539.1 |
Gene: | Gata4 / 14463 |
MGIID: | 95664 |
Length: | 442 |
Species: | Mus musculus |
Alignment Length: | 61 |
Identity: | 39/61 - (63%) |
Similarity: | 49/61 - (80%) |
Gaps: | 0/61 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 690 MSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERSK 750
:||:||.|.|||:|||:..||.||||||||.|||||.||.:||::.|.||:|:||.|.:||
Mouse 269 LSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSK 329
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5641 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2600 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000130 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR10071 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.860 |
|
Return to query results.
Submit another query.