DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and Gata4

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001297539.1 Gene:Gata4 / 14463 MGIID:95664 Length:442 Species:Mus musculus


Alignment Length:61 Identity:39/61 - (63%)
Similarity:49/61 - (80%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 MSCSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERSK 750
            :||:||.|.|||:|||:..||.||||||||.|||||.||.:||::.|.||:|:||.|.:||
Mouse   269 LSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 30/45 (67%)
ZnF_GATA 691..742 CDD:238123 33/50 (66%)
Gata4NP_001297539.1 GATA-N 1..204 CDD:368398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..107
ZnF_GATA 216..266 CDD:238123
ZnF_GATA 270..321 CDD:238123 33/50 (66%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..393 9/16 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2600
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.