DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and GATA5

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_536721.1 Gene:GATA5 / 140628 HGNCID:15802 Length:397 Species:Homo sapiens


Alignment Length:270 Identity:70/270 - (25%)
Similarity:115/270 - (42%) Gaps:82/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   595 RNMMSQPFAFPVPSTVSFTKVPEEPIALLKDLSEAQSS--------KSKPCRRK-------QSFP 644
            |...:.|...||.::.|.|    .|..:..|::::.::        ...|.||.       :.||
Human   123 REQFAAPLGRPVGTSYSAT----YPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLEEFP 183

  Fly   645 TK-TDCIDVVNENVTDTYTTSEATPDDKKDKRNINLFNA-------------IPGAQKDMS---- 691
            .: .:|::          ..:.:||..::|.....|.||             :...||.:|    
Human   184 GEGRECVN----------CGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRR 238

  Fly   692 ----CSNCGTLTTTIWRRSVRGEMVCNACGLYFKLHGVNRPHSMRRDTIHTRRRRPKELERSK-- 750
                |:||.|..||:|||:..||.||||||||.|||||.||.:|::::|.||:|:||.:.:::  
Human   239 AGLCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKARGS 303

  Fly   751 --KKHKQMSSCSSIETTKQDFLTAR------------------------ESLAISGLVLNKFKKE 789
              ......:|.|::.:|.....|::                        :|||...|   :||.|
Human   304 SGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHL---EFKFE 365

  Fly   790 IDDTETPAAA 799
            .:|...|:.|
Human   366 PEDFAFPSTA 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 29/55 (53%)
ZnF_GATA 691..742 CDD:238123 31/58 (53%)
GATA5NP_536721.1 GATA-N 1..170 CDD:283099 9/50 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116
ZnF_GATA 184..229 CDD:214648 7/54 (13%)
ZnF_GATA 188..232 CDD:238123 8/53 (15%)
ZnF_GATA <253..293 CDD:238123 24/39 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..356 12/74 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000130
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.