DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GATAd and ZGLP1

DIOPT Version :9

Sequence 1:NP_001260326.1 Gene:GATAd / 34395 FlyBaseID:FBgn0032223 Length:842 Species:Drosophila melanogaster
Sequence 2:NP_001096637.1 Gene:ZGLP1 / 100125288 HGNCID:37245 Length:271 Species:Homo sapiens


Alignment Length:161 Identity:41/161 - (25%)
Similarity:60/161 - (37%) Gaps:59/161 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   618 EPIAL-----------LKDLSEAQSSKSK-----------PCR--RKQSFPTK-TDCIDVVNENV 657
            :|:||           .||.....|.|.:           |.|  |||..|.: |:.:|...|.|
Human    83 DPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPSAPPQRRPRKQLNPCRGTERVDPGFEGV 147

  Fly   658 T--------------DTY-----TTSEATPDDKKDKRNINLFNAIPG----------AQKDMSCS 693
            |              .||     :.|:.:|.|.     :....|.||          |.:...|:
Human   148 TLKFQIKPDSSLQIIPTYSLPCSSRSQESPADA-----VGGPAAHPGGTEAHSAGSEALEPRRCA 207

  Fly   694 NCGTLTTTIWRRSVRGEMVCNACGLYFKLHG 724
            :|.|..|.:||.:..|..:|||||:.:|.:|
Human   208 SCRTQRTPLWRDAEDGTPLCNACGIRYKKYG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GATAdNP_001260326.1 zf-AD <228..284 CDD:214871
ZnF_GATA 688..736 CDD:214648 14/37 (38%)
ZnF_GATA 691..742 CDD:238123 14/34 (41%)
ZGLP1NP_001096637.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 96..141 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..199 6/33 (18%)
ZnF_GATA 202..>240 CDD:214648 14/37 (38%)
GATA 206..240 CDD:278735 14/33 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.