DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5037 and ppt1

DIOPT Version :9

Sequence 1:NP_609382.1 Gene:CG5037 / 34394 FlyBaseID:FBgn0032222 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_593219.2 Gene:ppt1 / 2543235 PomBaseID:SPAC56F8.04c Length:360 Species:Schizosaccharomyces pombe


Alignment Length:251 Identity:61/251 - (24%)
Similarity:103/251 - (41%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 MAPAAFDPT------TFAMCTLGTGLVSAAANAINQYHEVPFDSQMSRTKNRVLVTGQMTPLHAV 156
            ||..|:|.:      ..|:..:|:.|:.:|...||...:...|:::.|:|:|.|.:|:::...|:
pombe    93 MAAYAYDSSLVNVTKMLALFGVGSFLMRSAGCVINDLWDRELDAKVERSKSRPLASGKLSVRQAI 157

  Fly   157 TFAAVSATAGLSMLYFGVNGLTAALGAGNLFLYTTIYTPMKRISIVNTWVGSIVGAIPPLMGWAG 221
            :..:|..||.|.:| ..:|..|..||..:| :...||..||||:.....|..:......:|||..
pombe   158 SLLSVQLTASLGIL-LQLNPYTIKLGVASL-VPVCIYPAMKRITYYPQVVLGLTFGYGAVMGWPA 220

  Fly   222 CAATLDAGAMILAGVLYAWQFPHFNALSW-----------NLRPD-----YSRAGYRMMAVTNPG 270
            .|........::|.:       :.:.:||           :.|.|     ||.| .|....|.|.
pombe   221 LAGEACMNWSVVAPL-------YLSTISWIVLYDTIYAHQDKRDDVKANIYSTA-LRFGDNTKPV 277

  Fly   271 LCRRTALR-----------------YSVAIVG----LSAMAPVLDVTN-----YWF 300
            ||...||:                 |::.:.|    ||:|...:|:.:     .||
pombe   278 LCGLAALQIATLATAGIMNGQGPVFYTLGVAGAAYRLSSMIYKVDLDDPKDCFRWF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5037NP_609382.1 PT_UbiA_Cox10 78..344 CDD:260120 61/251 (24%)
ppt1NP_593219.2 ubiA_proteo 65..352 CDD:130539 61/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.