DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5037 and cox10

DIOPT Version :9

Sequence 1:NP_609382.1 Gene:CG5037 / 34394 FlyBaseID:FBgn0032222 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001120053.1 Gene:cox10 / 100145039 XenbaseID:XB-GENE-954608 Length:418 Species:Xenopus tropicalis


Alignment Length:273 Identity:169/273 - (61%)
Similarity:212/273 - (77%) Gaps:0/273 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KLSKFRLTSLVVITTMGGYAMAPAAFDPTTFAMCTLGTGLVSAAANAINQYHEVPFDSQMSRTKN 142
            :|||.|||:|||||...||||||..||||.|.:.::||||.|.|||:|||:.||||||.|:|||:
 Frog   131 RLSKIRLTALVVITASAGYAMAPVPFDPTCFLLASVGTGLASCAANSINQFFEVPFDSNMNRTKS 195

  Fly   143 RVLVTGQMTPLHAVTFAAVSATAGLSMLYFGVNGLTAALGAGNLFLYTTIYTPMKRISIVNTWVG 207
            |.||.||::||.|.:|||..|..|:|:|...||.||.||||.|:||||..||||||:||.|||||
 Frog   196 RPLVRGQISPLMATSFAAACAMPGVSLLTLAVNPLTGALGAFNIFLYTCCYTPMKRLSIANTWVG 260

  Fly   208 SIVGAIPPLMGWAGCAATLDAGAMILAGVLYAWQFPHFNALSWNLRPDYSRAGYRMMAVTNPGLC 272
            ::|||:||:|||.....:|||||::|..:||:||||||||||||||.||||.|||||:||:|.:|
 Frog   261 AVVGALPPVMGWTAATGSLDAGALLLGAILYSWQFPHFNALSWNLREDYSRGGYRMMSVTHPLMC 325

  Fly   273 RRTALRYSVAIVGLSAMAPVLDVTNYWFALETLPLNAYFAYLAYKFHEKSDSGSSRKLFRFSLIH 337
            ||.|||:.:|::|||.:||.||||.:.|.:.:||:|.|.:||.|:|::.:|..||||||..||.|
 Frog   326 RRVALRHCLALIGLSTLAPALDVTTWTFPIISLPINLYISYLGYRFYKDADRSSSRKLFFCSLWH 390

  Fly   338 LPALMLLFLTNKK 350
            ||.|:||..|.||
 Frog   391 LPMLLLLMFTCKK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5037NP_609382.1 PT_UbiA_Cox10 78..344 CDD:260120 164/265 (62%)
cox10NP_001120053.1 PT_UbiA_Cox10 132..387 CDD:260120 158/254 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 243 1.000 Domainoid score I2172
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H80170
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1260807at2759
OrthoFinder 1 1.000 - - FOG0004321
OrthoInspector 1 1.000 - - oto103500
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3592
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.