DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSGN1 and msgn1

DIOPT Version :9

Sequence 1:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:192 Identity:89/192 - (46%)
Similarity:108/192 - (56%) Gaps:36/192 - (18%)


- Green bases have known domain annotations that are detailed below.


Human     1 MDNLRETFLSLED--GLGSSDSPG---LLSSWDWKDRAGPFELNQASPSQSLSPAPSLES-YSSS 59
            |:.|....:.:||  .|.|...|.   :.|:||||:....:.|:|....||||||.|.|| ||||
 Frog     1 METLHHPLVKMEDDYALSSDSEPNSSCMASTWDWKNNDERYSLSQTPSPQSLSPAVSYESPYSSS 65

Human    60 PCPAVAGLPCEHGGASSGGSEGCSVGGASGLVEV--DYNMLAFQPTHLQGGGGPKAQK--GTKVR 120
                      .|               ..||.|:  .|::|.: |:...|..|...:|  |.|..
 Frog    66 ----------SH---------------TQGLEEMPFSYSLLQY-PSLCHGDNGDLTKKDHGHKPS 104

Human   121 MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLL 182
            |:||||||||||||||||.:|:|||||||.|||:|||..||||||||||.||.||.|||:||
 Frog   105 MTVQRRRKASEREKLRMRAIAEALHTLRNNLPPMYSQGRQPLTKIQTLKCTINYISELTNLL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59 13/25 (52%)
HLH 125..179 CDD:278439 43/53 (81%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 28/92 (30%)
bHLH_TS_Msgn1 102..167 CDD:381509 51/65 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 88 1.000 Domainoid score I32514
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10466
Inparanoid 1 1.050 129 1.000 Inparanoid score I12862
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG38057
OrthoDB 1 1.010 - - D1493381at2759
OrthoFinder 1 1.000 - - FOG0012027
OrthoInspector 1 1.000 - - oto153701
Panther 1 1.100 - - LDO PTHR20937
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6174
SonicParanoid 1 1.000 - - X9883
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1414.110

Return to query results.
Submit another query.