powered by:
Protein Alignment MSGN1 and hlh-15
DIOPT Version :9
Sequence 1: | NP_001099039.1 |
Gene: | MSGN1 / 343930 |
HGNCID: | 14907 |
Length: | 193 |
Species: | Homo sapiens |
Sequence 2: | NP_508440.1 |
Gene: | hlh-15 / 183427 |
WormBaseID: | WBGene00001959 |
Length: | 89 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 41/73 - (56%) |
Gaps: | 6/73 - (8%) |
- Green bases have known domain annotations that are detailed below.
Human 112 KAQKGTKVRMSVQRRRKASEREKLRMRTLADALHTLRNYLP--PVYSQRGQPLTKIQTLKYTIKY 174
||::..:.|.:.:.|...:.||::|:.:...|...||..|| ||..: |:||:.|:::|.|
Worm 20 KAERRKRRRATPKYRNLHATRERIRVESFNMAFSQLRALLPTLPVEKK----LSKIEILRFSIAY 80
Human 175 IGELTDLL 182
|..|.:||
Worm 81 ISFLDNLL 88
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.