powered by:
Protein Alignment MSGN1 and hlh-14
DIOPT Version :9
Sequence 1: | NP_001099039.1 |
Gene: | MSGN1 / 343930 |
HGNCID: | 14907 |
Length: | 193 |
Species: | Homo sapiens |
Sequence 2: | NP_495131.3 |
Gene: | hlh-14 / 182758 |
WormBaseID: | WBGene00001958 |
Length: | 148 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 22/74 - (29%) |
Similarity: | 38/74 - (51%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Human 121 MSVQRRRKASEREKLRMRTLADALHTLRNYLPPVYSQRGQPLTKIQTLKYTIKYIGELTDLLNRG 185
|:.:.:...:|||:.|:..:......|||.|.| ....:..:|..||:..:|||.:|..|||:.
Worm 1 MAKKNQVARNERERKRVHQVNHGFDVLRNRLQP--KNHTKKWSKADTLREAVKYIQQLQVLLNQD 63
Human 186 -REPRAQSA 193
::|...|:
Worm 64 PQQPSVSSS 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.