DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSGN1 and hlh-4

DIOPT Version :9

Sequence 1:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens
Sequence 2:NP_001379052.1 Gene:hlh-4 / 176372 WormBaseID:WBGene00001951 Length:205 Species:Caenorhabditis elegans


Alignment Length:57 Identity:17/57 - (29%)
Similarity:32/57 - (56%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   128 KASEREKLRMRTLADALHTLRNYLPPV--YSQRGQPLTKIQTLKYTIKYIGELTDLL 182
            |.:.||:.|:.|:..|...|:.:||.:  :::|   ::|::.|...|.||..|..|:
 Worm     7 KRNARERTRVHTVNQAFLVLKQHLPSLRQFTKR---VSKLRILNAAITYIDTLLKLI 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59
HLH 125..179 CDD:278439 15/52 (29%)
hlh-4NP_001379052.1 bHLH_TS_ASCL 5..60 CDD:381424 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.