DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Schip1 and schip1

DIOPT Version :9

Sequence 1:NP_001334735.1 Gene:Schip1 / 34393 FlyBaseID:FBgn0032221 Length:621 Species:Drosophila melanogaster
Sequence 2:NP_001017906.1 Gene:schip1 / 550605 ZFINID:ZDB-GENE-050417-466 Length:244 Species:Danio rerio


Alignment Length:260 Identity:67/260 - (25%)
Similarity:114/260 - (43%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 RDEIRKRLAIGD----------------KDSLNNDIKKEEFL-------TGSDNESYSSDSETCP 424
            |:.||::||:|.                |.||::.::....|       :|||.:|.:.||:|..
Zfish    16 RESIRQKLALGSFFDDGPGIYSSCSKSGKPSLSSRLQSGMNLQICFVNDSGSDKDSDADDSKTET 80

  Fly   425 KLSSGV--LRKQSEFCETKRNKEFENDKIFQKNQINQDKSMNHMNGNPIGTTDYPSDENLFFFAN 487
            .|.:.:  :.|||.....:...|.:::.:                            |::.|.:.
Zfish    81 SLDTPLSPMSKQSSSYSDRDTTEDDSESL----------------------------EDMDFLSR 117

  Fly   488 QSKLQIEVRIALAQSKEIAQMKVKARKHG--VTPIVDVIRSMLCDVGIKMNSNHRWISRQLLTGI 550
            |.|||.|.::|||.:|.:|:|:|:..|..  .:|:.|::..|          .|  ||..|:...
Zfish   118 QKKLQAEAKMALAVAKPMAKMQVEVEKQNRKKSPVADLLPHM----------PH--ISECLMKRS 170

  Fly   551 QVPT---------LQLLVNNLQEYIENLNVTLLESLKERDDLNSDQDDILHDLEKINNFFVFQQQ 606
            ..||         ||::||:|...||.||..|::.|..||:|:.:||.:|.|:|.:......||:
Zfish   171 LKPTDLRDMTHGQLQVIVNDLHSQIEGLNEELVQLLLMRDELHMEQDAMLVDIEDLTRHAQSQQK 235

  Fly   607  606
            Zfish   236  235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Schip1NP_001334735.1 None
schip1NP_001017906.1 SCHIP-1 12..238 CDD:287158 67/260 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595942
Domainoid 1 1.000 64 1.000 Domainoid score I10139
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003916
OrthoInspector 1 1.000 - - otm25942
orthoMCL 1 0.900 - - OOG6_108210
Panther 1 1.100 - - LDO PTHR13103
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.