DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and YMC1

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_015383.1 Gene:YMC1 / 856171 SGDID:S000006262 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:92/280 - (32%)
Similarity:138/280 - (49%) Gaps:23/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KMVVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISS 103
            ::|.|.:||..||.|.||||.||||.||.|||......    .....|.::..:...|.|:|..:
Yeast    24 RVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTT----AMEVVRKLLANEGPRGFYKGTLT 84

  Fly   104 PMGGIGLVNAIVFGVYGNVQRLSNDPN-------SLTSHFFAGSIAGVAQGFVCAPMELAKTRLQ 161
            |:.|:|...::.|||...::|..:..|       ||..::..|...|:...|:.:|:|..:.|||
Yeast    85 PLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQ 149

  Fly   162 LSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLM-------RQ 219
            ..|...:..:|.||:.|:|   |....:...:|||.||||:..|..:||:.:|.|:       |.
Yeast   150 TQTGSGTNAEFKGPLECIK---KLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRG 211

  Fly   220 VETPGV-AYTL-MAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNEGPQY 282
            :|...: |:.| :.|..:|.:.||..||:||:|:.||.|.|......|.....|...:.|.|...
Yeast   212 LERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGA 276

  Fly   283 FFRGLNSTLIRAFPMNAACF 302
            ||:|...|::||.|.|.|.|
Yeast   277 FFKGFGPTMLRAAPANGATF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 30/85 (35%)
PTZ00169 41..295 CDD:240302 87/269 (32%)
Mito_carr 128..218 CDD:278578 30/103 (29%)
Mito_carr 221..304 CDD:278578 30/84 (36%)
YMC1NP_015383.1 Mito_carr 25..111 CDD:395101 31/89 (35%)
Mito_carr 116..201 CDD:395101 28/87 (32%)
Mito_carr 215..307 CDD:395101 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I2520
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101471
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 1 1.000 - - X353
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.