DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and ORT1

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_014773.4 Gene:ORT1 / 854297 SGDID:S000005656 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:282 Identity:84/282 - (29%)
Similarity:140/282 - (49%) Gaps:28/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFI-GLYRGISSP 104
            ::|.:.|.:.||.|.::..|||||||.|||.  .:..:..|:.|.:...|.:... |.::||:||
Yeast    14 ILDIINGSIAGACGKVIEFPFDTVKVRLQTQ--ASNVFPTTWSCIKFTYQNEGIARGFFQGIASP 76

  Fly   105 MGGIGLVNAIVFGVYGNVQRL---SNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLST-Q 165
            :.|..|.||.:|..|....:.   ..:.:.|.....:|.:||.....|..|:||.|.:||::. |
Yeast    77 LVGACLENATLFVSYNQCSKFLEKHTNVSPLGQILISGGVAGSCASLVLTPVELVKCKLQVANLQ 141

  Fly   166 VDSG-IKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV--------- 220
            |.|. .|.|..:..:|.|:...|:.|.::|.:.|.:|:..|..::|.::|.:.:.:         
Yeast   142 VASAKTKHTKVLPTIKAIITERGLAGLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDP 206

  Fly   221 --ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALG-ANAKYNGFIDCAMKGFRNEGPQY 282
              :...:...|::||.||::...:.:|.|.||:.||.:.:. .||....|....:||        
Yeast   207 KRDESKIWELLISGGSAGLAFNASIFPADTVKSVMQTEHISLTNAVKKIFGKFGLKG-------- 263

  Fly   283 FFRGLNSTLIRAFPMNAACFFV 304
            |:|||..||.||.|.|||.|::
Yeast   264 FYRGLGITLFRAVPANAAVFYI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 29/84 (35%)
PTZ00169 41..295 CDD:240302 78/271 (29%)
Mito_carr 128..218 CDD:278578 26/91 (29%)
Mito_carr 221..304 CDD:278578 29/83 (35%)
ORT1NP_014773.4 Mito_carr 16..101 CDD:395101 29/86 (34%)
Mito_carr 103..200 CDD:395101 26/96 (27%)
Mito_carr 209..289 CDD:395101 29/85 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X353
TreeFam 1 0.960 - -
43.880

Return to query results.
Submit another query.