DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and CRC1

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_014743.1 Gene:CRC1 / 854267 SGDID:S000005626 Length:327 Species:Saccharomyces cerevisiae


Alignment Length:298 Identity:103/298 - (34%)
Similarity:134/298 - (44%) Gaps:51/298 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDK-----------F 94
            :..||||.:||...|..|||||.:||..|     |.:...|.|....|::..|           .
Yeast    36 IKSFVAGGVGGVCAVFTGHPFDLIKVRCQ-----NGQANSTVHAITNIIKEAKTQVKGTLFTNSV 95

  Fly    95 IGLYRGISSPMGGIGLVNAIVFGVYGNVQRL------SNDPNSLT--SHFFAGSIAGVAQGFVCA 151
            .|.|:|:..|:.|:..:.|:.|..|...::|      ....|.||  ....||.|:.:....|.|
Yeast    96 KGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQGGSNELTMGQMAAAGFISAIPTTLVTA 160

  Fly   152 PMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFE-- 214
            |.|..|..||.|::...       |...|.|||..||...|||..||:.||.||.|.||.|:|  
Yeast   161 PTERVKVVLQTSSKGSF-------IQAAKTIVKEGGIASLFKGSLATLARDGPGSALYFASYEIS 218

  Fly   215 --YL-MRQV-------ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFID 269
              || .||.       |...:....:|||.||||.|||.:|||.:||.:||.:...|      :.
Yeast   219 KNYLNSRQPRQDAGKDEPVNILNVCLAGGIAGMSMWLAVFPIDTIKTKLQASSTRQN------ML 277

  Fly   270 CAMKG--FRNEGPQYFFRGLNSTLIRAFPMNAACFFVV 305
            .|.|.  .:..|.:.||.||...|:|:||.|||.|..|
Yeast   278 SATKEIYLQRGGIKGFFPGLGPALLRSFPANAATFLGV 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 28/94 (30%)
PTZ00169 41..295 CDD:240302 96/286 (34%)
Mito_carr 128..218 CDD:278578 37/96 (39%)
Mito_carr 221..304 CDD:278578 34/84 (40%)
CRC1NP_014743.1 Mito_carr 35..131 CDD:395101 29/99 (29%)
Mito_carr 137..222 CDD:395101 35/91 (38%)
Mito_carr 235..326 CDD:395101 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.