DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and BOU

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001332469.1 Gene:BOU / 834724 AraportID:AT5G46800 Length:300 Species:Arabidopsis thaliana


Alignment Length:284 Identity:101/284 - (35%)
Similarity:155/284 - (54%) Gaps:25/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQ---TDDP-RNPKYKGTFHCFRTIVQRDKFIGLYRGISS 103
            |..:|.:||||.::|||||||:||.||   |..| :.|:|.|.....:..|..:...|||:|:.:
plant     7 DLASGTVGGAAQLVVGHPFDTIKVKLQSQPTPAPGQLPRYTGAIDAVKQTVASEGTKGLYKGMGA 71

  Fly   104 PMGGIGLVNAIVFGVYGNVQRL----SNDPNSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQ--- 161
            |:..:...||::|.|.|.::.|    :..|.:::..|.||:.||.|..|:..|.||.|.|||   
plant    72 PLATVAAFNAVLFTVRGQMEGLLRSEAGVPLTISQQFVAGAGAGFAVSFLACPTELIKCRLQAQG 136

  Fly   162 ------LSTQVDSGIKFTGPIHCLKYIVKTE-GIRGAFKGLTATILRDIPGFASYFVSFEYLMR- 218
                  .::.|.:.:|:.||:...::::::| |.||.||||..|..|::||.|:.|.::|...| 
plant   137 ALAGASTTSSVVAAVKYGGPMDVARHVLRSEGGARGLFKGLFPTFAREVPGNATMFAAYEAFKRF 201

  Fly   219 -----QVETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRNE 278
                 ...:.|....:||||.||.|.|...||.||||:.:|.|.. .|.:|.|.:|...|..::|
plant   202 LAGGSDTSSLGQGSLIMAGGVAGASFWGIVYPTDVVKSVLQVDDY-KNPRYTGSMDAFRKILKSE 265

  Fly   279 GPQYFFRGLNSTLIRAFPMNAACF 302
            |.:..::|....:.|:.|.|||||
plant   266 GVKGLYKGFGPAMARSVPANAACF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 33/85 (39%)
PTZ00169 41..295 CDD:240302 95/275 (35%)
Mito_carr 128..218 CDD:278578 34/99 (34%)
Mito_carr 221..304 CDD:278578 32/82 (39%)
BOUNP_001332469.1 Mito_carr 4..95 CDD:395101 34/87 (39%)
Mito_carr 101..206 CDD:395101 35/104 (34%)
Mito_carr 209..300 CDD:395101 32/82 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3726
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.