DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and slc25a15a

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_001074107.1 Gene:slc25a15a / 791156 ZFINID:ZDB-GENE-070112-1072 Length:303 Species:Danio rerio


Alignment Length:285 Identity:103/285 - (36%)
Similarity:142/285 - (49%) Gaps:30/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VVDFVAGLLGGAAGVLVGHPFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPM 105
            |:|..||..||.|.|:.|.||||.||.:||..   ..|:|..|||.::.::....|||:|.:..:
Zfish    10 VIDLSAGACGGTACVISGQPFDTAKVKMQTFP---GLYRGFVHCFVSVYKQVGLRGLYQGTTPAL 71

  Fly   106 GGIGLVNAIVFGVYG---NVQRLSN--DPNSLTSHF---FAGSIAGVAQGFVCAPMELAKTRLQ- 161
            ......||::|..||   ||.|..:  |.|:..|..   .:||:|.|.......|.||.|.||| 
Zfish    72 IANIAENAVLFMSYGFCQNVVRFLSGLDRNTELSDVQKACSGSVASVFSSLALCPTELVKCRLQA 136

  Fly   162 -----LSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQV- 220
                 .|.::.||.|.| ....::.:::|.|..|.::|||.||:|::||:..:|..:| |.|.: 
Zfish   137 MHEMEASGKIASGQKST-VWSVVRNVLRTNGPLGFYQGLTTTIVRELPGYFCFFGGYE-LSRSIF 199

  Fly   221 --------ETPGVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMKGFRN 277
                    |..||...:.:||..|...||..||||.||:.:|  .|....|..|||...|...||
Zfish   200 AHHMATDKEHIGVVPLMFSGGFGGACLWLVVYPIDCVKSRIQ--VLSLAGKQEGFIKTLMGILRN 262

  Fly   278 EGPQYFFRGLNSTLIRAFPMNAACF 302
            ||....:.||..|:||.||.|.|.|
Zfish   263 EGVAPLYSGLTPTMIRTFPANGALF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 33/86 (38%)
PTZ00169 41..295 CDD:240302 98/276 (36%)
Mito_carr 128..218 CDD:278578 33/98 (34%)
Mito_carr 221..304 CDD:278578 35/82 (43%)
slc25a15aNP_001074107.1 Mito_carr 9..93 CDD:278578 33/85 (39%)
Mito_carr 103..202 CDD:278578 32/100 (32%)
Mito_carr 208..299 CDD:278578 35/82 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.