DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4995 and SLC25A20

DIOPT Version :9

Sequence 1:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster
Sequence 2:NP_000378.1 Gene:SLC25A20 / 788 HGNCID:1421 Length:301 Species:Homo sapiens


Alignment Length:278 Identity:108/278 - (38%)
Similarity:154/278 - (55%) Gaps:24/278 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DFVAGLLGGAAGVLVGHPFDTVKVHLQTDDP----RNPKYKGTFHCFRTIVQRDKFIGLYRGISS 103
            :.:||..||...|.||||.|||||.|||..|    :.|.|.|||.|||..:.|:...|||||:::
Human    13 NLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAA 77

  Fly   104 PMGGIGLVNAIVFGVYGNVQRL-SNDPNSLTSH---FFAGSIAGVAQGFVCAPMELAKTRLQLST 164
            |:.|:..:.|:.|..:|..::| ...|..:.|:   |.||.::||....:..|.|..|..||:  
Human    78 PIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQI-- 140

  Fly   165 QVDSG-IKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVETP----- 223
            |..|| .|:||.:.|.|.:.:..||||.:||...|::||:|....||:::|:| :.:.||     
Human   141 QASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWL-KNIFTPEGKRV 204

  Fly   224 ---GVAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKY-NGFIDCAMKGFRNEGPQYFF 284
               .....|:|||.||:.:|....|.||:|:..|....|   || |||.|...:..|:||....:
Human   205 SELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPG---KYPNGFRDVLRELIRDEGVTSLY 266

  Fly   285 RGLNSTLIRAFPMNAACF 302
            :|.|:.:|||||.|||||
Human   267 KGFNAVMIRAFPANAACF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 37/85 (44%)
PTZ00169 41..295 CDD:240302 100/269 (37%)
Mito_carr 128..218 CDD:278578 34/93 (37%)
Mito_carr 221..304 CDD:278578 36/91 (40%)
SLC25A20NP_000378.1 Mito_carr 6..103 CDD:395101 38/89 (43%)
Solcar 1 8..99 37/85 (44%)
Mito_carr 106..198 CDD:395101 33/94 (35%)
Solcar 2 108..196 33/90 (37%)
Mito_carr 205..294 CDD:395101 34/83 (41%)
Solcar 3 207..293 34/81 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1756
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.